DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14997 and hmt2

Sequence 1:NP_647877.1 Gene:CG14997 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_596067.1 Gene:hmt2 PomBaseID:SPBC2G5.06c Length:459 Species:Schizosaccharomyces pombe

Alignment Length:435 Identity:167/436 (38%)
Similarity:255/436 (58%) Gaps:34/436 (8%)


  Fly    30 RFLSTSRVNRERQECQVLVVGGGTGGCAMAAKLSSRL---------GSD------KVVVLEPEDK 79
            ||.||..        :|||||||:.|.::|.::.::.         |.|      ::.:::....
pombe    23 RFASTHH--------KVLVVGGGSAGISVAHQIYNKFSKYRFANDQGKDTSLKPGEIGIVDGAKY 79

  Fly    80 HYYQPMFTLIGGGMKRLDQSHRQMADVLPT-KAKWVKEKALEFDPDNNTVSTSGGKTIKYDFLII 143
            |||||.:||.|.|:..:.::.|::|.::|. |.|...|......|..|.:.|..|:.|.||:|::
pombe    80 HYYQPGWTLTGAGLSSVAKTRRELASLVPADKFKLHPEFVKSLHPRENKIVTQSGQEISYDYLVM 144

  Fly   144 ATGLQLNYGKIPGLVEALETPDSNVCSIYSPKYVDHVYECLRRTNKGNAIFTFPNCPIKCAGAPQ 208
            |.|:..::|:|.||.|||:.|::.|.:|||.||.|.||..:.:|..||||||.|:..:|||||||
pombe   145 AAGIYTDFGRIKGLTEALDDPNTPVVTIYSEKYADAVYPWIEKTKSGNAIFTQPSGVLKCAGAPQ 209

  Fly   209 KIAYISEHYFRKMGRRDNVNIIYNTSLPVIFGVKHYAEALMKLIKR--RNITLNVQRNLVEVRHK 271
            ||.:::|.|:|:...|.|:::.:.|.:|.:|.||.|::||::..::  ||:.:|.:..||||:..
pombe   210 KIMWMAEDYWRRHKVRSNIDVSFYTGMPTLFSVKRYSDALLRQNEQLHRNVKINYKDELVEVKGS 274

  Fly   272 DNIAVFEDLAKPGVHYEETYSMLHVTPPMSTPDVVANCKKLVTPTGFVDVDQLTLQHNKYSNVFA 336
            :..|||::| ..|..:|..:.:||..|.|.:.:.:|. ..|...:|||.|||.|.|..|:.||||
pombe   275 ERKAVFKNL-NDGSLFERPFDLLHAVPSMRSHEFIAK-SDLADKSGFVAVDQSTTQSTKFPNVFA 337

  Fly   337 IGDSASSPNSKTAAAAAAQSPVVFKNVMAAIEGKAPTDIYDGYSSCPIVTGYSSCILAEFDYNLT 401
            |||.:..|.|||.||..||:||:..|:.:.:.||..|..|:||:|||::|||...|||||.|...
pombe   338 IGDCSGLPTSKTYAAITAQAPVMVHNLWSFVNGKNLTASYNGYTSCPLLTGYGKLILAEFLYKQE 402

  Fly   402 PVETFP-----LDQSKERYSMFFMKKELMPVLYWKL-MMNGYWNG 440
            |.|:|.     |||:..|...:.:||:..|.:||.. :.||.|.|
pombe   403 PKESFGRFSRFLDQTVPRRMFYHLKKDFFPFVYWNFAVRNGKWYG 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 110/301 (37%)
hmt2NP_596067.1 Pyr_redox_2 29..357 CDD:285266 126/338 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H10921
Inparanoid 1 1.050 297 1.000 Inparanoid score I599
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003734
OrthoInspector 1 1.000 T1125823
orthoMCL 1 0.900 OOG5_129122
Panther 1 1.100 LDO PTHR10632
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R564
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.