DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14997 and Y9C9A.16

Sequence 1:NP_647877.1 Gene:CG14997 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001263749.1 Gene:Y9C9A.16 WormBaseID:WBGene00021183 Length:422 Species:Caenorhabditis elegans

Alignment Length:412 Identity:185/413 (45%)
Similarity:265/413 (64%) Gaps:8/413 (2%)


  Fly    45 QVLVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDKHYYQPMFTLIGGGMKRLDQSHRQMADVLPT 109
            ::||||||.||..:|:|.:.:|.|..:.::||.:.|||||.|||:|||:..||.:.::..:::|.
 Worm    13 KLLVVGGGAGGLGIASKFTRKLPSGSLGIIEPLEDHYYQPGFTLVGGGLMTLDSNRKKQVNLIPK 77

  Fly   110 KAKWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIATGLQLNYGKIPGLVEALETPDSNVCSIYSP 174
            .|.|:::|...|:|..|||...||:.|.|::::||.|:.|.:..|.|.|||||||  .|||.|||
 Worm    78 GATWIQDKVETFNPSQNTVVLRGGEEISYEYMVIAMGIHLRFDMIKGAVEALETP--GVCSNYSP 140

  Fly   175 KYVDHVYECLRRTNKGNAIFTFPNCPIKCAGAPQKIAYISEHYFRKMGRRDNVNIIYNTSLPVIF 239
            .:|...|:.:....|||||:||||.||||||||||..||::...|:.|.||..::||.|||..||
 Worm   141 FHVQKHYQEVMNFQKGNAIYTFPNTPIKCAGAPQKACYITDSILRQRGVRDKAHMIYATSLSKIF 205

  Fly   240 GVKHYAEALMKLIKRRNITLNVQRNLVEVRHKDNIAVFE---DLAKP-GVHYEETYSMLHVTPPM 300
            ||.||.:||.|:.:.:.|.:..:|||:||...:..|:||   |.:|| ||..|..:|:||::||.
 Worm   206 GVDHYVKALEKVAQEKTIEVKTKRNLIEVVTNNKKAIFELLGDDSKPTGVTEEIEFSLLHISPPC 270

  Fly   301 STPDVVANCKKLVTPTGFVDVDQLTLQHNKYSNVFAIGDSASSPNSKTAAAAAAQSPVVFKNVMA 365
            :.|:.:.: ......|||:|||..|||...|.|||.:||..::||:||||:.:.....|..|:..
 Worm   271 TAPEPLRS-SHFADKTGFMDVDPQTLQSKNYPNVFGVGDCMNTPNAKTAASVSTHLKTVDTNLTQ 334

  Fly   366 AIEGKAPTDIYDGYSSCPIVTGYSSCILAEFDYNLTPVETFPLDQSKERYSMFFMKKELMPVLYW 430
            .::|..|...||||:|||:|...:..|||||..| ..:||.||:|||..|..|.||:.::|||||
 Worm   335 VMQGARPFMKYDGYASCPLVVSTNRVILAEFSPN-EILETTPLNQSKPSYWAFLMKRYILPVLYW 398

  Fly   431 KLMMNGYWNGPALMRKIFSVLK 452
            |.::.|:||||:.:|....:||
 Worm   399 KGLIKGHWNGPSTIRNFSRLLK 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 128/287 (45%)
Y9C9A.16NP_001263749.1 FadH2 21..>355 CDD:223523 148/337 (44%)
NADB_Rossmann <47..186 CDD:304358 69/141 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C257059460
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H10921
Inparanoid 1 1.050 363 1.000 Inparanoid score I1265
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1267127at2759
OrthoFinder 1 1.000 FOG0003734
OrthoInspector 1 1.000 T374910
orthoMCL 1 0.900 OOG5_129122
Panther 1 1.100 O PTHR10632
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R564
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.