DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14997 and sqrd-1

Sequence 1:NP_647877.1 Gene:CG14997 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001255798.1 Gene:sqrd-1 WormBaseID:WBGene00008538 Length:471 Species:Caenorhabditis elegans

Alignment Length:464 Identity:186/465 (40%)
Similarity:260/465 (56%) Gaps:63/465 (14%)


  Fly    45 QVLVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDKHYYQPMFTLIGGGMKRLDQSHRQMADVLPT 109
            ::||||||.||...|:|.:.:|....|.::||.:.|||||.|||:|||:..|:.:..:..|::|.
 Worm    13 KLLVVGGGAGGLGAASKFARKLPRGSVGIIEPREDHYYQPGFTLVGGGLMSLEANRGKQKDLIPK 77

  Fly   110 KAKWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIATGLQLNYGKIPGLVEALETPDSNVCSIYSP 174
            .|.|:::|..:|:|..|:|...||..|.||:::||.|:||.|..|.|..|||:||  .|||.|||
 Worm    78 NATWIQDKVQKFEPAKNSVKLRGGDEITYDYMVIAMGVQLRYDMIKGAKEALDTP--GVCSNYSP 140

  Fly   175 KYVDHVYECLRRTNKGNAIFTFPNCPIKCAGAPQKIAYISEHYFRKMGRRDNVNIIYNTSLPVI- 238
            .||:..|:.......|||::||||.||||||||||..||::...|:.|.||..::||.|||..: 
 Worm   141 FYVEKHYKEAMNFKGGNALYTFPNTPIKCAGAPQKACYITDSILRQRGVRDQAHMIYATSLKRVR 205

  Fly   239 ------------------------------------------------FGVKHYAEALMKLIKRR 255
                                                            ||::.|.::|.|:.:.:
 Worm   206 FLLCWDIINHGAIGNQKSKKKIRKHQLVTIDCFDNNILKQYNNFFFHLFGIESYLKSLEKVARDK 270

  Fly   256 NITLNVQRNLVEVRHKDNIAVFEDL---AKP-GVHYEETYSMLHVTPPMSTPDVVANCKKLVTPT 316
            .|.:..:|||:||...|.||.||.|   ||| |...:..||:||:.||.|||:.:.| ...|..|
 Worm   271 EIDVRTRRNLIEVNTNDRIATFELLDEEAKPTGKTEQIEYSLLHIGPPCSTPEALRN-SAFVDKT 334

  Fly   317 GFVDVDQLTLQHNKYSNVFAIGDSASSPNSKTAAAAAAQSPVVFKNVMAAIEGKAPTDIYDGYSS 381
            ||:|||..:||..||.|||.:||..::||:|||||.::....:.||:...::|..|...||||:|
 Worm   335 GFMDVDGGSLQSKKYPNVFGVGDCMNTPNAKTAAAVSSHLKTIEKNLTQVMQGNRPCMQYDGYAS 399

  Fly   382 CPIVTGYSSCILAEFDYNLTP---VETFPLDQSKERYSMFFMKKELMPVLYWKLMMNGYWNGPAL 443
            ||:|...:..|||||.    |   :||.|.||||..|..:.||:..||.|||..::.|||||||.
 Worm   400 CPLVVSTNRVILAEFG----PRGAMETTPFDQSKPTYWAYLMKRYFMPALYWNGLIKGYWNGPAT 460

  Fly   444 MRKIFSVLK 452
            :|....::|
 Worm   461 LRNCTRLVK 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 129/336 (38%)
sqrd-1NP_001255798.1 FadH2 28..>377 CDD:223523 135/352 (38%)
NADB_Rossmann 28..186 CDD:304358 73/160 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C257059248
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H10921
Inparanoid 1 1.050 363 1.000 Inparanoid score I1265
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1267127at2759
OrthoFinder 1 1.000 FOG0003734
OrthoInspector 1 1.000 T374910
orthoMCL 1 0.900 OOG5_129122
Panther 1 1.100 LDO PTHR10632
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R564
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.