DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:167 Identity:75/167 - (44%)
Similarity:96/167 - (57%) Gaps:27/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LAAPAISYAAPKLLAAPAISYAAPAI-SYAPKVLAAPVAVAK---VAVAEPYDPNPQYSFSYGVT 99
            ||..|::.|....:|||.:.:||||: :||    .||||||:   |..||.|||:|||.|||||.
  Fly     9 LAFVAVASAGYAPIAAPQVYHAAPAVATYA----HAPVAVAQKVVVKAAEEYDPHPQYRFSYGVD 69

  Fly   100 DHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKG-VAAVAI----- 158
            |..|||:|.|.|.....||.|.|||.:.||..|.|.||||.:|||||||.::. |.|||:     
  Fly    70 DKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVAVAPVVK 134

  Fly   159 ---------AKPALAVAAVPAITK----IGYASAPGL 182
                     |.||:|..|.||:.|    :.:.:||.:
  Fly   135 TVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 28/51 (55%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 28/51 (55%)

Return to query results.
Submit another query.