DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Ccp84Ag

DIOPT Version :8

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster

Alignment Length:144 Identity:61/145 (42%)
Similarity:77/145 (53%) Gaps:20/145 (14%)


  Fly    51 LLAAPAISYAAPAISYAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVN 115
            :|.|..|:.|:..|..|    |||:|.  ||..|.|||:|||::.|.|.|..:||||.|.||...
  Fly     7 ILFAACIAVASAGIIPA----AAPLAA--VAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREG 65

  Fly   116 GVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKGVAAVAIAKPALAVAAVPAITKIG----- 175
            .||.|.|||.:.||..|.|.||||.:|||||||.::.:.|...|.||..|||...:.:..     
  Fly    66 DVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPAAVVAAPAPVVRAAVAAPV 130

  Fly   176 ---------YASAP 180
                     ||:||
  Fly   131 VRAAPLTTTYAAAP 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:278791 27/52 (52%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.