DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr72Eb

DIOPT Version :10

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:89 Identity:23/89 - (25%)
Similarity:42/89 - (47%) Gaps:11/89 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISYAAPAISYAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGS 121
            ::..:|.:.|.|     |.....::.....|.:.||::.|....:    ||.:..| |:||:.|:
  Fly    15 LAVGSPTLEYGP-----PPTSDTISQYHHQDEHGQYAYGYMAPLY----SKHETRT-VDGVIRGT 69

  Fly   122 YSLAEPDGTIRKVTYTADKVNGFN 145
            :|..:.:|..:.|.|.|| ..||:
  Fly    70 FSHIDANGETQTVDYVAD-AEGFH 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 15/51 (29%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:459790 15/51 (29%)

Return to query results.
Submit another query.