DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr56F

DIOPT Version :8

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster

Alignment Length:157 Identity:39/158 (25%)
Similarity:58/158 (37%) Gaps:44/158 (28%)


  Fly    25 GLSAPGLTYAAPKLL----AAPAISYAAPKLLAAPAISYAAPAIS-------------------- 65
            |..:|...|..|:..    .||:.||.||  :|.|...|.|||::                    
  Fly    48 GYQSPSSNYLPPQRAGGNGGAPSNSYGAP--IAPPQGQYGAPALTGAIFKGGNGNGNGGYGGGNG 110

  Fly    66 ----YAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAE 126
                |..:            ..|.|.| .:|.|.|.|.|:.:|:.....|:....:..|.|.:..
  Fly   111 NGNGYGQR------------DEEQYGP-AKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLL 162

  Fly   127 PDGTIRKVTYTADKVNGFNAVVEKKGV 153
            |||..:.|.|.||: ||:...:..:.|
  Fly   163 PDGRKQIVEYEADQ-NGYRPTIRYEQV 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:278791 18/52 (35%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.