DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr64Ac and Cpr30B

Sequence 1:NP_647874.1 Gene:Cpr64Ac FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster

Alignment Length:135 Identity:45/136 (33%)
Similarity:60/136 (44%) Gaps:24/136 (18%)


  Fly    71 LAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVT 135
            ||:.|...::.....|.| ..|.|.:.|.|.||||.|.|:|:..:..|.|.|.|.:.||..|.|.
  Fly    13 LASAVWAIELQAEPDYGP-VAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQ 76

  Fly   136 YTADKVNGFNAVVEK-------------KGVAAVAIAKPALAVAAVPAITKIGYASAPG-----L 182
            |.||..|||.|:|::             |.:.|..|..|.|.||.:     :.||:...     |
  Fly    77 YKADDHNGFEAIVQREPTDIKIPLPEPPKKLLAAKILTPVLPVAPL-----VHYAAPKAIIKQEL 136

  Fly   183 SLGGY 187
            |.|.|
  Fly   137 SAGNY 141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:278791 24/52 (46%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.