DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr30F

DIOPT Version :8

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster

Alignment Length:189 Identity:56/190 (29%)
Similarity:77/190 (41%) Gaps:53/190 (28%)


  Fly     5 TLFVLGLILSAVVAIPIDPYGLSAPGLTYAAPKLLAAPAISYAAPKLLAAPAISYAAPAISYAPK 69
            :||:||:..:|.:.:||           |.:|..:..|.:.          .:...|||      
  Fly     6 SLFILGVGAAAAIELPI-----------YHSPAAIVKPLLK----------TVEVEAPA------ 43

  Fly    70 VLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKV 134
                                 .|.|:|.|.|.||||.|.|.|:.....|.|.|:|.:.||.:|.|
  Fly    44 ---------------------HYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTV 87

  Fly   135 TYTADKVNGFNAVVEKKGVAAVAIAKPALAVAAVPAITKIGYAS----APG-LSLGGYH 188
            .||:|..|||||||.:..:....|....:|....||...:.||:    ||. |.||.||
  Fly    88 DYTSDAHNGFNAVVRRDPLGQKVIKAAPIAKLLAPAPLPLAYAAPKLLAPAKLPLGLYH 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:278791 25/52 (48%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:278791 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.