powered by:
Protein Alignment Cpr64Ac and Cpr31A
DIOPT Version :9
| Sequence 1: | NP_647874.1 |
Gene: | Cpr64Ac / 38510 |
FlyBaseID: | FBgn0035512 |
Length: | 188 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_995678.1 |
Gene: | Cpr31A / 2768918 |
FlyBaseID: | FBgn0053302 |
Length: | 340 |
Species: | Drosophila melanogaster |
| Alignment Length: | 172 |
Identity: | 74/172 - (43%) |
| Similarity: | 97/172 - (56%) |
Gaps: | 16/172 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 19 IPIDP-----YGLSAPGLTYAAPKLLAAPAISYAAPKLLAAPAISYAAPAISYAPKVLAAPVAVA 78
:|..| |.|..|.:...||..||.|..:.....|.|||.: |||.:. .|.|||..:.
Fly 66 VPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVV--AAPVVK---TVAAAPAVLK 125
Fly 79 KVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNG 143
:|.: :.:|:|.|||||.|..|||.|.|.||...|.|.||||:.:.||..|.||||||.:||
Fly 126 QVEL----ESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDING 186
Fly 144 FNAVVEKKG-VAAVAIAKPALAVAAVPAITKIGYASAPGLSL 184
|||||:::. |||.|:|.|.::|:| ||...:..:|||..||
Fly 187 FNAVVQREPVVAARAVAAPVVSVSA-PAPVPVHISSAPVASL 227
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C9WU |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1544103at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.920 |
|
Return to query results.
Submit another query.