DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr64Ab and Cpr30B

Sequence 1:NP_647873.2 Gene:Cpr64Ab FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster

Alignment Length:123 Identity:47/124 (38%)
Similarity:64/124 (52%) Gaps:17/124 (14%)


  Fly     5 KITLICCALIAAIECALLPAAVPVGVPLNTEVDPHP-QYAFAYNVQDALTGDSKSQQEVRDGDVV 68
            |:|.:.|..:|:...|         :.|..|.|..| .|.|.::|.|..|||.|||:|.|..|.|
  Fly     4 KVTYLLCLCLASAVWA---------IELQAEPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKV 59

  Fly    69 KGSYSVVDADGSLRTVFYTADPINGFNAVVQRGP----VPVAARP---LVAPVAAPIL 119
            :|.|.::|:||..|.|.|.||..|||.|:|||.|    :|:...|   |.|.:..|:|
  Fly    60 EGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPLPEPPKKLLAAKILTPVL 117

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 26/52 (50%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.