DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tipE and Teh2

Sequence 1:NP_523920.1 Gene:tipE FlyBaseID:FBgn0003710 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001163345.1 Gene:Teh2 FlyBaseID:FBgn0035505 Length:313 Species:Drosophila melanogaster

Alignment Length:302 Identity:85/303 (28%)
Similarity:120/303 (40%) Gaps:108/303 (36%)


  Fly     3 DEQDKRTGKEKLLFYTTAFFILLGT---FSLFAFLFLVPFVIEPAFTTIFMQFEEVPALCETYDT 64
            :|.:..|..||..|||:   :.|||   .|:|.||||:|||::||.:||...::.||..|...|.
  Fly    73 EEIEMDTLLEKAKFYTS---VCLGTTAILSVFTFLFLIPFVVDPAISTIIADYDPVPVTCIVIDH 134

  Fly    65 EIYYGAKNCSWSSCREGCTKDIYTCTQIRVNYRLNLYNFTDEFNFTEYHINLKEAERILPPVKRT 129
            ....|.|||||||||||||..:..|.|:.|||        ....|:|:..|.::.:.:       
  Fly   135 IYAEGIKNCSWSSCREGCTSSLTKCHQLFVNY--------TRIPFSEWERNPRDLDTV------- 184

  Fly   130 DRYERALRSDYEYDNLGGGTGLDIDLGAGRMEQLNFGDADGSNGYLIEDSEDTRGLSASGTLISD 194
                   ..|..|..                             :||                  
  Fly   185 -------NWDVSYTK-----------------------------FLI------------------ 195

  Fly   195 ERRPFDEISELNEGLMGNRSMYYYVGARLFPNVKGCGYPPMLNCTIWLKRY--TKIGMKFPCYYS 257
                                           |.:||||||..||:|:.::|  :.||..|||:||
  Fly   196 -------------------------------NSEGCGYPPTTNCSIFARQYGFSHIGEPFPCFYS 229

  Fly   258 KVDPSLVISDLDYWQNTLNLVYSMAIPIPSFIISVIYLTYAY 299
            :..|.:||....:..|..:|:.|:.||...|.||:..|:|.|
  Fly   230 RAYPEVVIGRYSWENNLYHLILSLIIPNVLFAISIGVLSYWY 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tipENP_523920.1 TipE 1..452 CDD:293577 85/303 (28%)
Teh2NP_001163345.1 TipE 73..>271 CDD:293577 84/301 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130765462
eggNOG 1 0.900 E1_2CJ08
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12335
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.