DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ero1L and ero1a

DIOPT Version :8

Sequence 1:NP_647865.2 Gene:Ero1L / 38500 FlyBaseID:FBgn0261274 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001016058.1 Gene:ero1a / 548812 XenbaseID:XB-GENE-978124 Length:474 Species:Xenopus tropicalis

Alignment Length:489 Identity:226/490 (46%)
Similarity:309/490 (63%) Gaps:52/490 (11%)


  Fly    14 AAVVLVLLLLWTDTTGGYFAAIDETETSKNCFCELEGSINDCSCDVDTVDHFNNMKIYPRLQSLL 78
            :.:||..||||     |..:..:::..::.|||::.|.::||:|||:|:|||||..::|:||.|:
 Frog    15 SVLVLCSLLLW-----GSNSQQEQSSAAQRCFCQVTGYLDDCTCDVETIDHFNNYGLFPKLQQLV 74

  Fly    79 VKNFFRFYKVNLRQECPFWPDDSRCAMRFCQVENCEEQAIPQGIKDKGEHKEKAAFKYTREAQVG 143
            ..::||:||.||::.||||.|:|.|.::.|.|:.|....:| |:|..|       ||||.||...
 Frog    75 ASDYFRYYKANLKKPCPFWEDNSHCGVKDCAVKPCPTDEVP-GLKPPG-------FKYTEEANRA 131

  Fly   144 GSACSDGEDFDSSLGFLDTSISDQAHREFELWAKHDEAEEDFCIVDDHEE-GSQYVDLLLNPERY 207
            .....|.|. :..|..:|.|:|.:|......|.:||::.::||.:||.|. .::|||||.|||||
 Frog   132 HEEIDDCEK-EKRLSAVDESLSVEAQEAMLKWNRHDDSADNFCELDDEESPDAEYVDLLKNPERY 195

  Fly   208 TGYKGESAHRIWKSIYLENCF---------------GGNNETANKFSNYVPHLDLRNVCLEQRAF 257
            |||||....|||.|||.||||               .|.|| ...|.|:     |..:|:|:|||
 Frog   196 TGYKGADTWRIWNSIYEENCFKPKAVQRPLNPLTSTRGENE-GKVFYNW-----LDGLCVEKRAF 254

  Fly   258 YRIISGLHSSINIHLCSKYLLSESKDFLDPQGIWGPNVKEFKRRFSPETTSGEGPHWLRNLYFIY 322
            ||:|||||:|||||||:.|||.::  ::|.  |||.|..||::||....|.||||..|:||||||
 Frog   255 YRLISGLHASINIHLCANYLLKDT--WMDK--IWGHNTAEFQKRFDATLTQGEGPKRLKNLYFIY 315

  Fly   323 LIELRALAKAAPYLRREDY--YTGIAEEDDEVKLAINDMLSVIENFQSHFDENALFS-NGIASIK 384
            ||||||::|..|:..|..:  |||...:|.|.|..:.|:|....:|..|||||:||| :...:.|
 Frog   316 LIELRAISKVLPFFERSSFLLYTGNETKDTETKKLLLDVLLDARDFPLHFDENSLFSGDKKEAAK 380

  Fly   385 FKHDYKEKFRNISRIMSCVGCDKCKLWGKLQTQGLGTALKILYSEK-LNLATESGLWDKPHIEAD 448
            .|.|:::.|||||:||.||||.||:|||||||||||||||||:||: :...:||   ::|     
 Frog   381 LKEDFRQHFRNISKIMDCVGCFKCRLWGKLQTQGLGTALKILFSERQIENLSES---NQP----- 437

  Fly   449 PIFRLSRTEIVALFNAFGRLSNSIYEMENFRCVL 482
            ..|.|:|.|||||||||.|:|.|:.|:||||.:|
 Frog   438 SEFHLTRQEIVALFNAFARISTSVKELENFRTLL 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ero1LNP_647865.2 ERO1 69..473 CDD:282050 198/424 (47%)
ero1aNP_001016058.1 ERO1 66..462 CDD:282050 198/423 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274332815
eggNOG 1 0.900 E1_COG5061
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 414 1.000 Inparanoid score I1695
OMA 1 1.010
OrthoDB 1 1.010 D1181226at2759
OrthoFinder 1 1.000 FOG0001386
OrthoInspector 1 1.000 T601396
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R413
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.