DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ero1L and ero-1

DIOPT Version :8

Sequence 1:NP_647865.2 Gene:Ero1L / 38500 FlyBaseID:FBgn0261274 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001252399.1 Gene:ero-1 / 173325 WormBaseID:WBGene00001334 Length:513 Species:Caenorhabditis elegans

Alignment Length:507 Identity:197/508 (39%)
Similarity:283/508 (56%) Gaps:71/508 (14%)


  Fly    16 VVLVLLLLWTDTTGGYFAAIDETETSKNCFCELEGSINDCSCD-VDTVDHFNNMKIYPRLQSLLV 79
            :||.|:::..:|         :.|:.:.|||:...::..|.|. ..|:|..||.:||.::|.||.
 Worm     9 IVLSLIIIVVNT---------QFESGRLCFCKGFEAVEPCDCSKPQTIDKLNNHRIYEKVQKLLK 64

  Fly    80 KNFFRFYKVNLRQECPFWPDDSRCAMRFCQVENCEEQAIPQGIKDKG------------------ 126
            |:||||||||:.:.||||.||.:|....|.:..|::: :|.|::.:.                  
 Worm    65 KDFFRFYKVNMDKTCPFWADDRQCGTNQCGIAFCDDE-VPAGLRRRNAVNMVRRSSHESSHEISE 128

  Fly   127 EHKEKAAFKYTREAQVG-----GSACSDGEDFD--------SSLGFLDTSISDQAHREFELWAKH 178
            .|......::....::|     .:|..:.||.|        :::..:|.::.|...|:.:....|
 Worm   129 NHNNNRQQRWNETTKIGVIVQEAAAVKEEEDDDAEKCADAGNNIDPMDRTLHDDEKRQLDAMDHH 193

  Fly   179 DEAEED-FC-IVDDHEEGSQYVDLLLNPERYTGYKGESAHRIWKSIYLENCFGGNNETANKF-SN 240
            |:..|| || |.||..:|..||||..||||||||.|:|..|:|||||.||||    :...|| .|
 Worm   194 DDGLEDKFCEIEDDESDGMHYVDLSKNPERYTGYAGKSPQRVWKSIYEENCF----KPDPKFDKN 254

  Fly   241 YVPHLDLRNVCLEQRAFYRIISGLHSSINIHLCS---KYLLSESKDFLDPQGIWGPNVKEFKRRF 302
            ::.:.....:|||:|.|||:||||||:|.|.:.:   |........|....|.|..|.:.|..||
 Worm   255 FLTNPSNFGMCLEKRVFYRLISGLHSAITISIAAYNYKPPPPSLGQFGSQMGTWFRNTEMFAGRF 319

  Fly   303 SPETTSGEGPHWLRNLYFIYLIELRALAKAAPYLRREDYYTGIAEEDDEVKLAINDMLSVIENFQ 367
            ..: .|.|||..|||:|||||:|||||.||||||:.|.:|||...||.|.:.|:.|:|..|..:.
 Worm   320 GTK-WSWEGPQRLRNVYFIYLLELRALLKAAPYLQNELFYTGNDVEDAETRKAVEDLLEEIRAYP 383

  Fly   368 SHFDENALFSNGIAS--IKFKHDYKEKFRNISRIMSCVGCDKCKLWGKLQTQGLGTALKILYSEK 430
            :||||:.:|: |:.|  ...:.:::..|.||||||.||.||||:||||:||.|:|||||||:|  
 Worm   384 NHFDESEMFT-GVESHARALREEFRSHFVNISRIMDCVECDKCRLWGKVQTHGMGTALKILFS-- 445

  Fly   431 LNLATESGLWDKPHI---EADPIFRLSRTEIVALFNAFGRLSNSIYEMENFR 479
                      |.||.   :....|:|:|.|:|||..:|||.|:||.|::|||
 Worm   446 ----------DLPHSHYKQDSSKFQLTRNEVVALLQSFGRYSSSILEVDNFR 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ero1LNP_647865.2 ERO1 69..473 CDD:282050 179/446 (40%)
ero-1NP_001252399.1 ERO1 54..480 CDD:282050 178/445 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274319712
eggNOG 1 0.900 E1_COG5061
Hieranoid 1 1.000
Homologene 1 1.000 H8740
Inparanoid 1 1.050 337 1.000 Inparanoid score I1390
Isobase 1 0.950 0 Normalized mean entropy S2105
OMA 1 1.010
OrthoDB 1 1.010 D1181226at2759
OrthoFinder 1 1.000 FOG0001386
OrthoInspector 1 1.000 T477463
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12613
Phylome 1 0.910 0.977 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R413
TreeFam 1 0.960
1413.850

Return to query results.
Submit another query.