DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KRT1 and LamC

Sequence 1:NP_006112.3 Gene:KRT1 HGNCID:6412 Length:644 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster

Alignment Length:421 Identity:112/422 (27%)
Similarity:206/422 (49%) Gaps:72/422 (17%)


Human   177 KSREREQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTR-THNLEPYFESFINNLRR 240
            :.:|:|:::.||::.|.:||::|.||.:|..|..:..|.|  ||..| |.||:..:|..:...|:
  Fly    43 RQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQ--DTVNRETSNLKAVYEKELAAARK 105

Human   241 RVDQLKSDQSRLDSELKNMQDMVED---------------------YRNKYEDEINKRTN----- 279
            .:|:...::::|:.::|.:.:..:|                     |.|:| :|:|.:.|     
  Fly   106 LLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRY-NEVNGKYNQSLAD 169

Human   280 ------------AENEFV-----TIKKDVDGAYMTKVDLQAKLDNLQQEIDFLTALYQAEL---- 323
                        .|||.:     .::|.::...:.:|||:.:..:|::|:.|...::..||    
  Fly   170 RKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETR 234

Human   324 SQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYEDIAQKSKAEAESLYQSKYEELQITAGRHG 388
            |:.|.:|||.:..||  ......|...:.|::.|||...:.::.|.|.||.::.:.|:..|.|  
  Fly   235 SRRQIEISEIDGRLS--RQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANR-- 295

Human   389 DSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQR---GENALKDAKNKLN----D 446
             :.:.|.:...|    ::.:|::||.:..::.||:.:.:....|   .||.|...:.:.|    .
  Fly   296 -AAQGSALATEE----VRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIAS 355

Human   447 LEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEESRMS----GECAPNVSVSVST 507
            ||..||:.::::|..|::||.||:.|::||||||.|..||.|||.|::    |....:..:|.:.
  Fly   356 LEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNG 420

Human   508 SHTTISGGGSRGGGGGGYGSGGSSYGSGGGS 538
            ||.|.| ..||.|.....|...::.|..|.|
  Fly   421 SHLTAS-ASSRSGRVTPSGRRSATPGISGSS 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KRT1NP_006112.3 Head 2..179 0/2 (0%)
Keratin_2_head <145..176 CDD:292825
Filament 180..492 CDD:278467 98/367 (27%)
Coil 1A 180..215 13/35 (37%)
Linker 1 216..234 8/19 (42%)
Coil 1B 235..326 24/138 (17%)
Linker 12 327..350 7/23 (30%)
Coil 2 351..489 44/145 (30%)
DUF883 405..>465 CDD:295076 16/67 (24%)
Tail 490..644 15/54 (28%)
Keratin_2_tail 493..>512 CDD:292827 5/23 (22%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 98/368 (27%)
ATP-synt_B <67..>142 CDD:304375 18/77 (23%)
MreC <178..>224 CDD:302802 10/46 (22%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.