DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and Psmc2

DIOPT Version :10

Sequence 1:NP_647848.2 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_035318.2 Gene:Psmc2 / 19181 MGIID:109555 Length:433 Species:Mus musculus


Alignment Length:111 Identity:22/111 - (19%)
Similarity:40/111 - (36%) Gaps:32/111 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GFDATCSLVVLGPQGSPLTVS----KSGEAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVS 137
            |||...::.||.....|.|:.    :.|.        :|.:.|....::....| :.|.....:|
Mouse   308 GFDPRGNIKVLMATNRPDTLDPALMRPGR--------LDRKIEFSLPDLEGRTH-IFKIHARSMS 363

  Fly   138 LEMEVPKLLWLKRNLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCS 183
            :|.::.                   |:|...|...:||.:.||:|:
Mouse   364 VERDIR-------------------FELLARLCPNSTGAEIRSVCT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_647848.2 5C_CHO_kinase 6..540 CDD:273552 22/111 (20%)
Psmc2NP_035318.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PRK03992 44..430 CDD:179699 22/111 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.