DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11594 and LOC1278830

DIOPT Version :10

Sequence 1:NP_647848.2 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_061506478.1 Gene:LOC1278830 / 1278830 VectorBaseID:AGAMI1_005008 Length:494 Species:Anopheles gambiae


Alignment Length:89 Identity:17/89 - (19%)
Similarity:35/89 - (39%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKRNLSQTFGNIWRVFDLPD--FLTWRATGVD 177
            |||.|::......   :.|.:|.|..:...::.|:..:::...|..|..|..:  :...|.....
Mosquito   408 EQEIQQLVTLSEG---WTGDEVRLACKEASMMLLRNRINERRSNTNRAADQEELQYSMLRKAFEQ 469

  Fly   178 TRSLCSVVCKWNYDAANGSWNKEF 201
            .|..|..:.:.:.|     ||:.:
Mosquito   470 LRPGCVELAQKHRD-----WNQRY 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11594NP_647848.2 5C_CHO_kinase 6..540 CDD:273552 17/89 (19%)
LOC1278830XP_061506478.1 None

Return to query results.
Submit another query.