DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and tas

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_417311.1 Gene:tas / 947306 ECOCYCID:G7462 Length:346 Species:Escherichia coli


Alignment Length:259 Identity:60/259 - (23%)
Similarity:94/259 - (36%) Gaps:67/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VEYYFKHNDGTHIQGIGLGTFA----STEGDCERAVLHAIDVGYRHIDTAYFYG----------N 55
            ::|:...:....:..:||||..    ::|.|....:.:|:..|...||.|..|.          .
E. coli     1 MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLT 65

  Fly    56 EAEVGAAVRKKIAEGVIKREDIFITTKLWCNFHEPER----------------VEYACRKTLKNI 104
            |..||..:.|   .|  .||.:.|.:|:    ..|.|                :..|...:||.:
E. coli    66 ETYVGNWLAK---HG--SREKLIIASKV----SGPSRNNDKGIRPDQALDRKNIREALHDSLKRL 121

  Fly   105 GLDYVDLYLIHWP---------FSYKYRGDNELIPKDANGEVELVDIDYLDTWGAMEKLVDLGLT 160
            ..||:|||.:|||         ..|.:        .|:...|.|     |||..|:.:....|..
E. coli   122 QTDYLDLYQVHWPQRPTNCFGKLGYSW--------TDSAPAVSL-----LDTLDALAEYQRAGKI 173

  Fly   161 KSIGVSNFNEEQLTRLLANC------KIKPIHNQIEVHPALDQKKLIALCKKNGILVTAFSPLG 218
            :.|||||.....:.|.|...      :|..|.|...:.....:..|..:.:..|:.:.|:|.||
E. coli   174 RYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 60/259 (23%)
Tas 12..299 CDD:223739 59/252 (23%)
tasNP_417311.1 tas 1..346 CDD:236727 60/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.