DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and AAD10

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_012689.1 Gene:AAD10 / 853620 SGDID:S000003916 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:272 Identity:52/272 - (19%)
Similarity:93/272 - (34%) Gaps:80/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 REDIFITTKL----------------WCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKY 122
            |:.|.|.||.                :|..|: ..:..:.|.:|:.:..|::|:..:||   :.|
Yeast     7 RDQIVIATKFTTDYKGYDVGKGKSANFCGNHK-RSLHVSVRDSLRKLQTDWIDILYVHW---WDY 67

  Fly   123 RGDNELIPKDANGEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSN-------------------- 167
            ....|          |::|        ::..||..|....:|||:                    
Yeast    68 MSSIE----------EVMD--------SLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTP 114

  Fly   168 FNEEQ-----LTRLLANCKIKPI--HNQIEVHP-------ALDQKKLIALCKKNGI-LVTAFSPL 217
            |:..|     |.|.... .|.|:  |..:.:.|       ....||.:...||.|. |.|.|...
Yeast   115 FSIYQGKWNVLNRDFER-DIIPMARHFGMALAPWDVMGGGRFQSKKAVEERKKKGEGLRTFFGTS 178

  Fly   218 GRHNAELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELG--TIPLPKSSNPKRIEENFNVFDF 280
            .:.:.|::    :.:..::...:...:|:..:.|.||....  ..||......:.:::|......
Yeast   179 EQTDMEVK----ISEALLKVAEEHGTESVTAIAIAYVRSKAKHVFPLVGGRKIEHLKQNIEALSI 239

  Fly   281 KLDAEDHAILDS 292
            ||..|....|:|
Yeast   240 KLTPEQIKYLES 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 52/272 (19%)
Tas 12..299 CDD:223739 52/272 (19%)
AAD10NP_012689.1 AKR_SF <1..250 CDD:412396 50/269 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.