DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and akr1c3

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001072181.1 Gene:akr1c3 / 779627 XenbaseID:XB-GENE-5821909 Length:324 Species:Xenopus tropicalis


Alignment Length:316 Identity:141/316 - (44%)
Similarity:188/316 - (59%) Gaps:11/316 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YFKHNDGTHIQGIGLGTFAS---TEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAE 69
            |.:.|||..:..||.||:|.   .:...|.....||||||||||.|:.||||.|||.|:|.|||:
 Frog     8 YVELNDGHKMPVIGFGTYAPPKFPKSLAEEGTKVAIDVGYRHIDCAFLYGNEEEVGRAIRAKIAD 72

  Fly    70 GVIKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDAN 134
            |.:||||:|.|.|||...|.||||..|..|:||::.|||:||::||.|..:| .|| :|.|.|.|
 Frog    73 GTVKREDVFYTGKLWSTSHTPERVRPALEKSLKDLQLDYMDLFIIHMPMEFK-PGD-DLFPADEN 135

  Fly   135 GEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQ 197
            |:....:.|..|||.|:||..|.||.:||||||||.:||..:|  ...|.||:.||:|.|..|:|
 Frog   136 GKFIYHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHVYLNQ 200

  Fly   198 KKLIALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELG 258
            .||:..||...|::..:|.||...    .|..||..:.|..:..||.|:|::.|||.:||.::.|
 Frog   201 SKLLEFCKSKDIVLVGYSVLGSSRDERWIEASTPVLLEDPALTEIAKKHNRTPAQVAMRYHLQRG 265

  Fly   259 TIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            .:.|.||..|.||::||.||||:|||||...:|..:...|.....:......||::
 Frog   266 VVVLAKSFTPARIQQNFQVFDFQLDAEDMRSIDGLNRNMRYIDTSRWSDHPKYPYS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 138/298 (46%)
Tas 12..299 CDD:223739 137/295 (46%)
akr1c3NP_001072181.1 AKR_AKR1C1-35 8..308 CDD:381334 139/301 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.