DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and akr1c4

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_031753743.1 Gene:akr1c4 / 496490 XenbaseID:XB-GENE-5895888 Length:328 Species:Xenopus tropicalis


Alignment Length:314 Identity:138/314 - (43%)
Similarity:192/314 - (61%) Gaps:19/314 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFASTE---GDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVIK 73
            :||..|..:||||:||.|   .|...|...|||:||||||.||.||||.::|.|:|.|||:|.:|
 Frog    20 HDGNAIPVMGLGTYASAEVPKSDGTEATKLAIDLGYRHIDCAYIYGNEVQIGEAIRSKIADGTVK 84

  Fly    74 REDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDA--NGE 136
            ||:||.|.||||:|..|..|......:||.:.|||:||:::|||||.|        |.||  |..
 Frog    85 REEIFYTGKLWCSFFSPNLVRQGLEASLKALQLDYLDLFIMHWPFSVK--------PSDAHSNQP 141

  Fly   137 VELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLA--NCKIKPIHNQIEVHPALDQKK 199
            ::..|:|:..||.|:|...|.||.|||||||||..||.|||:  ..|.||:.||:|.|..|:|.|
 Frog   142 LDFDDVDFCLTWEALEGCKDAGLVKSIGVSNFNRRQLERLLSKPGLKYKPVCNQVEYHVYLNQSK 206

  Fly   200 LIALCKKNGILVTAFSPLG--RHN--AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELGTI 260
            |...||.:.|::.|:|.||  |.|  .:..:|..:.|..::::|.|||:|.|:|.:|::::.|.:
 Frog   207 LHEYCKCHNIVLVAYSVLGTARDNTWVDPNSPVLLEDPVLRSVAAKYNRSPAEVAMRFILQKGAV 271

  Fly   261 PLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPFN 314
            .|.||.||.|:::|..||:|:|..||..:||..:...|.|......:...|||:
 Frog   272 VLAKSFNPTRLKQNLGVFEFELKPEDMEMLDGLNRNLRYAQFTVMKQHPEYPFH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 133/296 (45%)
Tas 12..299 CDD:223739 133/297 (45%)
akr1c4XP_031753743.1 AKR_SF 15..313 CDD:412396 135/300 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.