DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12766 and CG2767

Sequence 1:NP_647839.1 Gene:CG12766 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster

Alignment Length:327 Identity:133/328 (41%)
Similarity:199/328 (61%) Gaps:29/328 (9%)


  Fly     8 YFKHNDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVI 72
            :...|:|..:..||:||:.:::.:.|.|:..|::.||||||||..||||..:|..:::.:..|.:
  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70

  Fly    73 KREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNEL-IPKDANGE 136
            |||::||.||:....:.|..||...:|:|:::.||||||||:|.||:.....|... :.|:...|
  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLME 135

  Fly   137 VELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLI 201
            |: |..::...|.|||.||:.|||||||||||:::|:.|||.||||:|.:||||.|..|.|:.|:
  Fly   136 VD-VTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLV 199

  Fly   202 ALCKKNGILVTAFSPLG-----RHNA------ELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVI 255
            ..||...|.|||:||||     :.||      :|  |..|...:|:.||..:.|:.|||::|::|
  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDL--PDLMDIPEVKEIAASHGKTPAQVLLRWII 262

  Fly   256 ELGTIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDS------------YHNGERVAHARQAIKS 308
            :.|...:|||:||.|:::|.:||||:|.||:.|.|.|            :|..||  |.....|:
  Fly   263 DTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVER--HPEFTFKN 325

  Fly   309 KY 310
            :|
  Fly   326 QY 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 129/314 (41%)
Tas 12..299 CDD:223739 130/311 (42%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 127/299 (42%)
Tas 10..297 CDD:223739 125/290 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11732
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1770
55.040

Return to query results.
Submit another query.