DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and CG2767

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster


Alignment Length:327 Identity:133/327 - (40%)
Similarity:199/327 - (60%) Gaps:29/327 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YFKHNDGTHIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAEGVI 72
            :...|:|..:..||:||:.:::.:.|.|:..|::.||||||||..||||..:|..:::.:..|.:
  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70

  Fly    73 KREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNEL-IPKDANGE 136
            |||::||.||:....:.|..||...:|:|:::.||||||||:|.||:.....|... :.|:...|
  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLME 135

  Fly   137 VELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHNQIEVHPALDQKKLI 201
            |: |..::...|.|||.||:.|||||||||||:::|:.|||.||||:|.:||||.|..|.|:.|:
  Fly   136 VD-VTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLV 199

  Fly   202 ALCKKNGILVTAFSPLG-----RHNA------ELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVI 255
            ..||...|.|||:||||     :.||      :|  |..|...:|:.||..:.|:.|||::|::|
  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDL--PDLMDIPEVKEIAASHGKTPAQVLLRWII 262

  Fly   256 ELGTIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDS------------YHNGERVAHARQAIKS 308
            :.|...:|||:||.|:::|.:||||:|.||:.|.|.|            :|..||  |.....|:
  Fly   263 DTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVER--HPEFTFKN 325

  Fly   309 KY 310
            :|
  Fly   326 QY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 128/313 (41%)
Tas 12..299 CDD:223739 129/310 (42%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 127/298 (43%)
Tas 10..297 CDD:223739 125/289 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I232
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I161
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm51343
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
98.970

Return to query results.
Submit another query.