DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and Akr1c13

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_006516545.1 Gene:Akr1c13 / 27384 MGIID:1351662 Length:324 Species:Mus musculus


Alignment Length:315 Identity:127/315 - (40%)
Similarity:176/315 - (55%) Gaps:15/315 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYFKHNDG--THIQGIGLGTFASTEGDCERAVLHAIDVGYRHIDTAYFYGNEAEVGAAVRKKIAE 69
            :...|.||  ..:..|.:....|.|..|     .|:||||||:||||.|..|.|:|.|::.||..
Mouse    13 FIVNHYDGEKEDLVKINVPKSKSLEAAC-----LALDVGYRHVDTAYAYQVEEEIGQAIQSKIKA 72

  Fly    70 GVIKREDIFITTKLWCNFHEPERVEYACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDAN 134
            ||:||||:||||||||....||.|:.|..|:||.:.|||||||::|:|...| .|||: .|.:..
Mouse    73 GVVKREDLFITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVPMK-SGDND-FPVNEQ 135

  Fly   135 GEVELVDIDYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLL--ANCKIKPIHNQIEVHPALDQ 197
            |:..|..:|:.|||..:|:..|.||.|||||||||..||.|:|  ...|.||:.||:|.|..|:|
Mouse   136 GKSLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQ 200

  Fly   198 KKLIALCKKNGILVTAFSPLGRHN----AELRTPTFMYDGKVQAIADKYNKSIAQVVIRYVIELG 258
            :||:..|:...|::.|:..||...    .:..:|..:.|..:..:|.|..:|.|.:.:||:|:.|
Mouse   201 RKLLDYCESKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRG 265

  Fly   259 TIPLPKSSNPKRIEENFNVFDFKLDAEDHAILDSYHNGERVAHARQAIKSKYYPF 313
            .:||.:|.....:.||..||.|:|..||...||..:...|...|...:....|||
Mouse   266 IVPLAQSFKENEMRENLQVFGFQLSPEDMKTLDGLNKNFRYLPAEFLVDHPEYPF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 122/298 (41%)
Tas 12..299 CDD:223739 121/294 (41%)
Akr1c13XP_006516545.1 AKR_AKR1C1-35 30..309 CDD:381334 119/285 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.