DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and SPAC977.14c

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_592785.1 Gene:SPAC977.14c / 2543325 PomBaseID:SPAC977.14c Length:351 Species:Schizosaccharomyces pombe


Alignment Length:354 Identity:76/354 - (21%)
Similarity:127/354 - (35%) Gaps:102/354 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NDGTHIQGIGLGTFA------------STEGDCERAVLHAIDVGYRHIDTAYFYG---NEAEVGA 61
            |.|..:..:.||..:            ..|.:..:.:..|.|.|.|..|||..|.   :|..||.
pombe    14 NSGLKVSKLILGCMSYGKKEYWEDWVLEDEEEVFKIMKAAYDAGIRTFDTANCYSAGVSEELVGK 78

  Fly    62 AVRKKIAEGVIKREDIFITTKLWCNF---------------------HEPE----------RVEY 95
            .:||.    .|.|..|.|.:|  |.|                     ..||          .:..
pombe    79 FIRKY----EIPRSSIVILSK--CFFPVRKDLIKIFGDLSSRGVHFLDSPELANQCGLSRKHIFD 137

  Fly    96 ACRKTLKNIGLDYVDLYLIHWPFSYKYRGDNELIPKDANGEVELVDIDYLDTWGAMEKLVDLGLT 160
            |...::|.:| .|:|:..||     :|         |.:...|       :...|:..:|:.|..
pombe   138 AVEDSVKRLG-TYIDVLQIH-----RY---------DPHVSAE-------EVMRALNDVVESGKV 180

  Fly   161 KSIGVSNFNEEQLTRLLANCKIKPIHNQIEV---HPAL---DQKKLIALCKKNGILVTAFSPLGR 219
            :.||.|.....|...|....:....|..|.:   |..|   :::::|..|:|.|:.:..:|||.|
pombe   181 RYIGASTMRCYQFIELQNTAEKHGWHKFISMQNYHNLLYREEEREMIPYCQKTGVGLIPWSPLAR 245

  Fly   220 ---------HNAELRTPTFMYD-------------GKVQAIADKYNKSIAQVVIRYVIELGTIPL 262
                     :...:|:.|.:|.             .:|:.:|.|||.|:|.:...:.:..|..|:
pombe   246 GLLTRSIDANEETIRSKTDLYTRALEFGAGYKAILSRVEELAKKYNVSMATLATAWSLHKGDYPI 310

  Fly   263 PKSSNPKRIEENFNVFDFKLDAEDHAILD 291
            ...|..:|:::.....:.||..||...|:
pombe   311 VGISKVERLKDALAAVELKLSEEDIKYLE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 76/354 (21%)
Tas 12..299 CDD:223739 76/354 (21%)
SPAC977.14cNP_592785.1 Tas 12..342 CDD:223739 76/354 (21%)
Aldo_ket_red 12..340 CDD:119408 76/354 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.