DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12766 and SPCC737.06c

DIOPT Version :9

Sequence 1:NP_647839.1 Gene:CG12766 / 38462 FlyBaseID:FBgn0035476 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_588368.1 Gene:SPCC737.06c / 2539059 PomBaseID:SPCC737.06c Length:287 Species:Schizosaccharomyces pombe


Alignment Length:208 Identity:53/208 - (25%)
Similarity:94/208 - (45%) Gaps:42/208 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KREDIFITTKLWCNFHEPERVEYACR-KTLKNI--------GLDYVDLYLIHWPF--SYKYRGD- 125
            |:|:..|..||:  |.:.|.::...| :||..:        |:|:|...::.:|.  ..|..|: 
pombe    76 KQEEYEIIVKLF--FLDGENIDIKKREETLSQVFYNLHMLFGIDFVSTLVVSFPHITFLKESGNS 138

  Fly   126 --NELIPKDANGEVELVDI-DYLDTWGAMEKLVDLGLTKSIGVSNFNEEQLTRLLANCKIKPIHN 187
              ||:.  |:..|:...:| .::|||..:|:.|..|...::|||.|...:|.||:::..:.|...
pombe   139 SSNEIY--DSIDEIPPQEIQSWVDTWKLLEEKVGEGKIGTLGVSEFGVNELQRLISSVNVVPEST 201

  Fly   188 QIEVHPALDQKKLIALCK-KNGILVTAFSPLGRHNAEL---RTPT-FMYDGKVQAIADKY----- 242
            ||.:...         || .|.:|..|    .||:.:|   ..|: .:.:.::.::..|.     
pombe   202 QINIGQN---------CKLPNDLLNFA----DRHHLKLFFHSDPSALLSESEITSVIHKACPEIP 253

  Fly   243 NKSIAQVVIRYVI 255
            |.:....||||.|
pombe   254 NPARVDWVIRYTI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12766NP_647839.1 ARA1 5..298 CDD:223729 53/208 (25%)
Tas 12..299 CDD:223739 53/208 (25%)
SPCC737.06cNP_588368.1 ARA1 4..283 CDD:223729 53/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.