DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KRAS and Rap1

Sequence 1:NP_001356715.1 Gene:KRAS HGNCID:6407 Length:189 Species:Homo sapiens
Sequence 2:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster

Alignment Length:190 Identity:102/191 (53%)
Similarity:138/191 (72%) Gaps:7/191 (4%)


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |.|||:||:|:|||||||||:|.:|..||::|||||||||||||.:||:.|:|:||||||.|:::
  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

Human    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL-PSRTVDTKQ 129
            ||||.||:.|:||:.|::|....:|.|:...||||.||||::||||||||||||| ..|.|..:.
  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130

Human   130 AQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 189
            .::||..:...|:|||||.:..|.|.||.|||:|.:   |...|::|.|   |...|:::
  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINK---KSPEKKQKKP---KKSLCVLL 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KRASNP_001356715.1 H_N_K_Ras_like 3..164 CDD:133338 95/162 (59%)
Effector region 32..40 8/8 (100%)
Hypervariable region 166..185 5/19 (26%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 95/162 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.