| Sequence 1: | NP_647821.2 | Gene: | CG10357 / 38435 | FlyBaseID: | FBgn0035453 | Length: | 321 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598863.3 | Gene: | Pla1a / 85031 | MGIID: | 1934677 | Length: | 456 | Species: | Mus musculus | 
| Alignment Length: | 261 | Identity: | 87/261 - (33%) | 
|---|---|---|---|
| Similarity: | 122/261 - (46%) | Gaps: | 52/261 - (19%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    37 PSADVSLENVEQLSSVE-----SVKLIVHGYLGSCTHGS-IMPLRNAYTAQGYENVLVADWGPVA 95 
  Fly    96 NLDYPSSRL---AVKNVAQI-------LAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYF 150 
  Fly   151 NGSLGRVTGLDPALPLFSSRS-DDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQP 214 
  Fly   215 GCENVDVVAASKLLHEAYS---CSHNRAVMFYAESIGMPENFPAVSCSLTAI-----KSRRVEDC 271 
  Fly   272 L 272 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG10357 | NP_647821.2 | Pancreat_lipase_like | 28..308 | CDD:238363 | 87/261 (33%) | 
| Pla1a | NP_598863.3 | Lipase | 14..336 | CDD:333880 | 87/261 (33%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_28N19 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR11610 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||