DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and pnliprp2

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001072431.1 Gene:pnliprp2 ID: Length:468 Species:Xenopus tropicalis

Alignment Length:323 Identity:102/324 (31%)
Similarity:148/324 (46%) Gaps:51/324 (16%)


  Fly    26 LLNQSTIYYLKPSADVSLE-NVEQLS-----SVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYE 84
            ::|...:.:.:.:||...| |...:|     :....:.|:||::...|.|.:..:.||..:....
 Frog    52 MVNTRFLLFTRDNADHFQEINSSTISDSYFQTTRKTRFIIHGFIDVGTEGWVPDMCNAMLSVEDI 116

  Fly    85 NVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRY 149
            |.|..||...::.||..:...|:.|...:|.|::......|.|...|||||||||||.||..|:.
 Frog   117 NCLSTDWSDGSHTDYVQAANNVRVVGAEVADLVKTLRDDLGYSPSLVHVIGHSLGAHAAGEAGKR 181

  Fly   150 FNGSLGRVTGLDPALPLFSSRSDD-SLHSNAAQFVDVIHTDYPLF------GDIRPRGTVDFYPN 207
            ..| :||:||||||.|.|....:: .|..:.|..|||||||...|      |..:..|.:||:||
 Frog   182 MPG-IGRITGLDPAQPYFQDTPEEVRLDPSDATLVDVIHTDSAPFIPSLGLGTGQLSGHLDFFPN 245

  Fly   208 FGLAPQPGCE-----NV-DVVAASKLLHEAYSCSHNRAVMFYAESIGMPE---NFPAVSCSLTAI 263
            .|: ..|||:     |: |:..|.:..|:...|:|.|:..:|.|||..|.   .|||  .|..:.
 Frog   246 GGI-QMPGCKQKEEYNISDIFIAFQGKHDDLVCNHLRSYRYYMESITTPSGFTGFPA--ASYESF 307

  Fly   264 KSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLY---------YYLETNGAPPYGQGR 317
            .|.....|          .||:...  ||.:    |.||         |||.|..:||:.:.|
 Frog   308 SSGAGFPC----------PANECPV--MGHY----ADLYSGATPSSQTYYLNTGDSPPFARWR 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 99/311 (32%)
pnliprp2NP_001072431.1 Lipase 20..350 CDD:278576 101/318 (32%)
Pancreat_lipase_like 53..346 CDD:238363 99/313 (32%)
PLAT 353..444 CDD:294016 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.