DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Pnlip

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip MGIID:97722 Length:465 Species:Mus musculus

Alignment Length:314 Identity:93/315 (30%)
Similarity:142/315 (45%) Gaps:41/315 (13%)


  Fly    28 NQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPL-RNAYTAQGYENVLVADW 91
            |::...|...::|.|........:....::|:||::.......:..: :|.:..:.. |.:..||
Mouse    60 NENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLSDMCKNMFRVESV-NCICVDW 123

  Fly    92 GPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGR 156
            ...:...|..:...|:.|...:|.|:.......|.||..||:||||||:||||..|:...|::||
Mouse   124 KGGSRTTYTQATQNVRVVGAEVALLVNVLQSDLGYSLNNVHLIGHSLGSHIAGEAGKRTFGAIGR 188

  Fly   157 VTGLDPALPLFSSRSDD-SLHSNAAQFVDVIHTDY-PL-----FGDIRPRGTVDFYPNFGLAPQP 214
            :||||||.|.|....:: .|....|||||.||||. |:     ||..:..|.:||:||.|: ..|
Mouse   189 ITGLDPAEPYFQGTPEEVRLDPTDAQFVDAIHTDAGPIIPNLGFGMSQTVGHLDFFPNGGI-EMP 252

  Fly   215 GCEN------VDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCS----LTAIKSRRVE 269
            ||:.      ||:....:......:|:|.|:..||.:||..|..|...|||    .||.|     
Mouse   253 GCQKNILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIVNPTGFAGFSCSSYSLFTANK----- 312

  Fly   270 DCLREKSKTNTENANDYQTVFMGEHVNR----SATLY--YYLETNGAPPYGQGR 317
             |....|....:         ||.:.:|    ::.||  :||.|.....:.:.|
Mouse   313 -CFPCGSGGCPQ---------MGHYADRYPGKTSRLYQTFYLNTGDKSNFARWR 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 92/304 (30%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 92/309 (30%)
Pancreat_lipase_like 51..348 CDD:238363 92/305 (30%)
PLAT_PL 355..465 CDD:238857 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.