DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Liph

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001037744.1 Gene:Liph RGDID:1592849 Length:451 Species:Rattus norvegicus

Alignment Length:323 Identity:104/324 (32%)
Similarity:157/324 (48%) Gaps:55/324 (17%)


  Fly     6 LCLV--------PILCQFLGLHAALLDSLLN-QSTIYYLKPSADVSLENVEQLSSVESVK---LI 58
            :|||        |...: |..|:|::.:.|: :..:|..:......:.|...|.|:...|   .|
  Rat    11 MCLVKSDTDETCPSFTR-LSFHSAVVGTGLSVRLMLYTQRDQTCAQVINSTALGSLNVTKKTTFI 74

  Fly    59 VHGYLGSCTHGS----IMPLRNAYTAQGYENVLVADWGPVA-NLDYPSSRLAVKNVAQILAKLLE 118
            :||:..:   ||    :..|..:..:....||:|.||...| .:.||.:....:.||.||.:.::
  Rat    75 IHGFRPT---GSPPVWMEELVQSLISVQEMNVVVVDWNRGATTVIYPHASSKTRKVALILKEFID 136

  Fly   119 EFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSR-SDDSLHSNAAQF 182
            :.|.: |.||:.:::||.||||||||.:|..::|.|||:||||||.|||:.| .:|.|..:.|||
  Rat   137 QMLAK-GASLDNIYMIGVSLGAHIAGFVGEMYSGKLGRITGLDPAGPLFNGRPPEDRLDPSDAQF 200

  Fly   183 VDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESI 247
            |||||:|....|.....|.:|||||.|| .||||... :....|.    :.|.|..:|..|..|:
  Rat   201 VDVIHSDTDALGYREALGHIDFYPNGGL-DQPGCPKT-IFGGIKY----FKCDHQMSVFLYLASL 259

  Fly   248 GMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQT---VFMGE-HVNRSATLYYYLE 306
               :|    :||:||.      .|         ::..||:.   |..|. |:....:|.||.:
  Rat   260 ---QN----NCSITAY------PC---------DSYRDYRNGKCVSCGAGHIVSCPSLGYYAD 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 96/294 (33%)
LiphNP_001037744.1 Pancreat_lipase_like 41..310 CDD:238363 96/293 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.