DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG34447

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster

Alignment Length:280 Identity:97/281 (35%)
Similarity:133/281 (47%) Gaps:53/281 (19%)


  Fly    55 VKLIVHGYLGS---CTHGSIMPLRNAYTAQGYENVLV--ADWGPVANLDYPSSRLAVKN---VAQ 111
            :|:::|||.|.   ..:..|.|:     ...:|:|.|  .|:||:..  ||....||:|   |::
  Fly    74 LKILIHGYTGDRDFAPNSYIRPV-----LLDHEDVYVISIDYGPLVR--YPCYIQAVQNLPLVSR 131

  Fly   112 ILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSRSDD-SL 175
            .||:|:...:.|..::.:.:|:||.|||..:||:...|....:.|:||||||.|||....|. .|
  Fly   132 CLAQLINNLVDRAIVANDQIHLIGFSLGGQVAGQTANYVKRKMKRITGLDPAKPLFILGPDSRRL 196

  Fly   176 HSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGC--ENVDVVAASKLLHEAYSCSHNR 238
            ....|.||||||||....|.:|..|.|||||||| |.||||  ||         :.:..||:|.|
  Fly   197 DKGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFG-AKQPGCMEEN---------MQDPSSCNHER 251

  Fly   239 AVMFYAESIGMPENFPAVSCS------LTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNR 297
            |..||||||.....|.|..||      ||...:...:                   ..:|.||:.
  Fly   252 APRFYAESINTTVGFWARQCSGWLLQLLTLCPTTGAQ-------------------ALLGYHVSD 297

  Fly   298 SATLYYYLETNGAPPYGQGR 317
            .....|:|:|....||..|:
  Fly   298 ELRGSYFLQTASKSPYALGK 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 94/270 (35%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 94/271 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.