DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG34448

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001097059.1 Gene:CG34448 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster

Alignment Length:291 Identity:91/292 (31%)
Similarity:136/292 (47%) Gaps:39/292 (13%)


  Fly    35 LKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLD- 98
            |.|..||....:       .:|:::||::|:......:.:|:........||:..|:|.:.... 
  Fly    63 LNPQKDVFQPRL-------PLKILIHGFIGNRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPC 120

  Fly    99 -YPSSRLAVKN---VAQILAKLLEEFLQRHGIS-LEGVHVIGHSLGAHIAGRIGRYFNGSLGRVT 158
             ||   .||.|   |::.||:::...:.. ||| .|.:|:||.||||.:||.:..|.:..|.|:|
  Fly   121 YYP---WAVNNAPIVSECLAQMINNLISA-GISRREDIHLIGFSLGAQVAGMVANYVSQPLARIT 181

  Fly   159 GLDPALPLFSSRS--DDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDV 221
            |||||.|.|..:.  ...|.::.|.|||:||||...|..:.|.|..|||||.....|.||..:. 
  Fly   182 GLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGCSYIS- 245

  Fly   222 VAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSC-SLTAIKSRRVEDCLREKSKTNTENAND 285
                  ....|:|:|.||.::|.|||.....|.|..| ......|:|   |....:..||:    
  Fly   246 ------NWRFYNCNHYRAAVYYGESIISERGFWAQQCGGWFDFFSQR---CSHYSNMPNTQ---- 297

  Fly   286 YQTVFMGEHVNRSATLYYYLETNGAPPYGQG 316
                 ||..|:..|:..|:|.|:...|:.:|
  Fly   298 -----MGYFVSEDASGSYFLTTHEVAPFAKG 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 89/282 (32%)
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 89/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.