DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:305 Identity:97/305 - (31%)
Similarity:134/305 - (43%) Gaps:49/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAK---LL 117
            :.|:||:|..........:..........|.:..||...:...|..   ||:|:..:.|:   |:
Human    90 RFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQ---AVQNIRVVGAETAFLI 151

  Fly   118 EEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSRSDD-SLHSNAAQ 181
            :....:.|.|||.|||||||||||.|...||...|.:||:||||||.|.|....:: .|..:.|.
Human   152 QALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAV 216

  Fly   182 FVDVIHTD-YPL-----FGDIRPRGTVDFYPNFGLAPQPGC-ENV-----DVVAASKLLHEAYSC 234
            |||||||| .|:     ||..:..|.:||:||.| ...||| :||     |:....:.:....||
Human   217 FVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGG-KEMPGCKKNVLSTITDIDGIWEGIGGFVSC 280

  Fly   235 SHNRAVMFYAESIGMPENFPAVSC-SLTAIKSRRVEDCLRE------------KSKTNTENANDY 286
            :|.|:..:|:.|:..|:.|....| |....:..:...|..|            |.||:...    
Human   281 NHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVE---- 341

  Fly   287 QTVFM--GEHVN-------RSATLYYYLETNG---APPYGQGRNS 319
            ||.|:  ||..|       .|.||....:.||   ...||...||
Human   342 QTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 91/289 (31%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 87/271 (32%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 3/11 (27%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 3/21 (14%)
PLAT_PL 357..469 CDD:238857 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.