DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG6271

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651526.1 Gene:CG6271 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster

Alignment Length:265 Identity:88/266 (33%)
Similarity:139/266 (52%) Gaps:35/266 (13%)


  Fly    56 KLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEF 120
            :.::||:..|..:.....:|.|:.::|..||:|.||....::||.:|.:||....:.:||::...
  Fly   103 RFVIHGWTQSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSVMAVAATGKKVAKMINFL 167

  Fly   121 LQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFS-SRSDDSLHSNAAQFVD 184
            ...||::|..|:|||||||||:||..|:..:|.:..:.|||||||||| ::.:..|:|:.|.:|:
  Fly   168 KDNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVE 232

  Fly   185 VIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGM 249
            .|.|:....|.::|.|...||||.| ..||||. :||..|         |||.|:..:|||::. 
  Fly   233 SIQTNGGTLGFLKPIGKGAFYPNGG-KTQPGCP-LDVTGA---------CSHGRSTTYYAEAVS- 285

  Fly   250 PENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLY-----YYLETNG 309
            .:||..:.|.       ..|:.:.:      |..:.|.:|.||...|    .|     :|:..|.
  Fly   286 EDNFGTMKCG-------DYEEAVAK------ECGSTYSSVRMGADTN----AYMVEGDFYVPVNS 333

  Fly   310 APPYG 314
            ..|:|
  Fly   334 KAPFG 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 85/258 (33%)
CG6271NP_651526.1 Lipase 57..337 CDD:278576 87/263 (33%)
Pancreat_lipase_like 68..333 CDD:238363 86/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.