DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG6277

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651525.1 Gene:CG6277 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster

Alignment Length:311 Identity:100/312 (32%)
Similarity:157/312 (50%) Gaps:47/312 (15%)


  Fly    22 LLDS--LLNQSTIYYLKPSAD--------VSLENVE--QLSSVESVKLIVHGYLGSCTHGSIMPL 74
            ||:|  |......:||..|::        .|.::::  ..:|....:.::||:..|.|......:
  Fly    57 LLESRGLTTVPVKFYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDI 121

  Fly    75 RNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLG 139
            |:|:.::|..||:|.||....::||.:|.|||....:.:||::......||::|..::|||||||
  Fly   122 RSAWLSRGDYNVIVVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLG 186

  Fly   140 AHIAGRIGRYFNGSLGRVTGLDPALPLFS-SRSDDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVD 203
            ||:||..|:..:|.:..:.|||||||||| ::.:..|:|:.|.:|:.|.|:....|.::|.|...
  Fly   187 AHVAGYAGKNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGA 251

  Fly   204 FYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRV 268
            ||||.| ..|||| .:|:..|         |||.|:..:|||::. .:||..:.|.         
  Fly   252 FYPNGG-KTQPGC-GLDLTGA---------CSHGRSTTYYAEAVS-EDNFGTMKCG--------- 295

  Fly   269 EDCLREKSKTNTENANDYQTVFMGEHVNRSATLY-----YYLETNGAPPYG 314
             |.....||   |..:.|.:|.||...|    .|     ||:..|...|:|
  Fly   296 -DYEEAVSK---ECGSTYSSVRMGADTN----AYMVEGDYYVPVNSKAPFG 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 93/296 (31%)
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 94/294 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.