DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG17192

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651522.1 Gene:CG17192 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster

Alignment Length:305 Identity:94/306 (31%)
Similarity:150/306 (49%) Gaps:47/306 (15%)


  Fly    28 NQSTIY-YLKPSADVSLENVEQLSSV--------ESVKLIVHGYLGSCTHGSIMPLRNAYTAQGY 83
            |:.:.| |.|.:.....|.....||:        ...:.::||:.|..|....:.:..|:.::|.
  Fly    61 NEVSFYLYTKQNPTEGQEITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAWLSKGD 125

  Fly    84 ENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGR 148
            .||:|.:|....::||..|..||......:.::::...:.|.:|||.:.|||||||||:||..|:
  Fly   126 FNVIVVNWARSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGK 190

  Fly   149 YFNGSLGR-----VTGLDPALPLFS-SRSDDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPN 207
                .:|:     :.|||||||||| ...|..|.|..|.:|:.|.|:..:.|.::|.|...||.:
  Fly   191 ----QVGQKRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYVS 251

  Fly   208 FGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPEN-FPAVSCSLTAIKSRRVEDC 271
            .| ..|||| .||:         |.:|||.|:|::|||:|  .|| |.|:.|          :| 
  Fly   252 GG-RKQPGC-GVDL---------AGTCSHARSVIYYAEAI--TENSFGAIQC----------QD- 292

  Fly   272 LREKSKTNTENANDYQTVFMGEHVNR-SATLYYYLETNGAPPYGQ 315
              .::..:.|..:.:.:|.|.|..|. :...::|:..|...|:||
  Fly   293 --YQAALDNECGSSFSSVRMAEDTNAYNVEGHFYVPVNSEAPFGQ 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 90/297 (30%)
CG17192NP_651522.1 Lipase 55..333 CDD:278576 92/302 (30%)
Pancreat_lipase_like 62..329 CDD:238363 90/297 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.