DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG4582

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster

Alignment Length:295 Identity:94/296 (32%)
Similarity:139/296 (47%) Gaps:56/296 (19%)


  Fly    48 QLSSVESVKLIVHGYLG---SCTHGSIMP----LRNAYTAQGYENVLVADWGPVANLDYPSSRLA 105
            :.|.....::::||:||   :..:..::|    |||     |..|:...|||..|..||.::...
  Fly   158 RFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRN-----GNYNIFTVDWGRGAIADYITASYR 217

  Fly   106 VKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYF-NGSLGRVTGLDPALPLFS- 168
            ||.|.|:|||.::...|..|:..|.:.::|.|:|||:||..|::. .|.|..:..||||||.|. 
  Fly   218 VKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRY 282

  Fly   169 SRSDDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYS 233
            ::..:.|.:..|.:|:|:||....:|..||.|.||||.|:| :.||||          ..||   
  Fly   283 AKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWG-SQQPGC----------FWHE--- 333

  Fly   234 CSHNRAVMFYAESIGMPE--NFPAVSC------SLTAIKSRRVEDCLREKSKTNTENANDYQTVF 290
            |||.||.|.:|||:...:  .|.:..|      .||     |...|.::.....|..        
  Fly   334 CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLT-----RFHRCPKDTGVMQTMG-------- 385

  Fly   291 MGEHVNRSATL------YYYLETNGAPPYGQGRNS 319
             |:..|.||..      .||.:||..|||...:|:
  Fly   386 -GDLANVSAEFLAQRQGVYYFQTNDQPPYVLAQNA 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 89/283 (31%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 90/284 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.