DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and LIPC

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC HGNCID:6619 Length:511 Species:Homo sapiens

Alignment Length:299 Identity:89/300 (30%)
Similarity:133/300 (44%) Gaps:76/300 (25%)


  Fly    57 LIVHGY-LGSCTHGSIMPLRNAYTAQGYE--NVLVADWGPVANLDYP----SSRLAVKNVAQILA 114
            :|:||: :.......|..:..|..:|..:  ||.:.||..:|:..|.    ::||..|.||.:| 
Human    97 MIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAALL- 160

  Fly   115 KLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGS--LGRVTGLDPALPLF-SSRSDDSLH 176
            :.|||.:|   :|...||:||:|||||::|..|....|:  :||:||||.|.||| .|...:.|.
Human   161 RWLEESVQ---LSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLFEGSAPSNRLS 222

  Fly   177 SNAAQFVDVIHTDYPLF---------GDIRPRGTVDFYPNFGLAPQPGCENVDVVA-----ASKL 227
            .:.|.|||.|||    |         |..:|.|..|||||.| :.||||..:::..     ....
Human   223 PDDANFVDAIHT----FTREHMGLSVGIKQPIGHYDFYPNGG-SFQPGCHFLELYRHIAQHGFNA 282

  Fly   228 LHEAYSCSHNRAVMFYAESI------------GMPENFP---AVSCSLTAIKSRRVEDCLREKSK 277
            :.:...|||.|:|..:.:|:            |...:|.   .:||               :|.:
Human   283 ITQTIKCSHERSVHLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSC---------------KKGR 332

  Fly   278 TNTENANDYQTVFMGEHVN---RSATLYYYLETNGAPPY 313
            .||          :|.||.   ||.:...:|.|....|:
Human   333 CNT----------LGYHVRQEPRSKSKRLFLVTRAQSPF 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 88/293 (30%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.