DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG10116

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster

Alignment Length:262 Identity:73/263 (28%)
Similarity:114/263 (43%) Gaps:49/263 (19%)


  Fly    62 YLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGI 126
            :||:.:...|..:.:|...|...|::..|... ||    .....:.:||.::..|..:|    .:
  Fly    63 WLGNISSPEIPAVVSARLQQQDSNIISVDLSE-AN----DETEIIDSVASLVIVLHNQF----DM 118

  Fly   127 SLEGVHVIGHSLGAHIAGRIGRYFNGSLGR----VTGLDPALPLFSSRSDDSLHSNAAQFVDVIH 187
            .|:.:.|:|.:.|||:||.:.......|||    :|.|||:   ..:..|..|....|:||:|:|
  Fly   119 PLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPS---SGAELDHKLSQADAEFVEVVH 180

  Fly   188 TDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPEN 252
            |:....|.....|.||:|||.| ..|||| ..|            ||||.||....|| :..|||
  Fly   181 TNAGGEGTWERLGHVDYYPNGG-QTQPGC-TTD------------SCSHERAFELLAE-MWSPEN 230

  Fly   253 -FPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMG--EHVNRSATLYYYLETNGAPPYG 314
             |.:..|.  ::::.....|             .:.|..||  :...:.|:..|:|||..:.|:.
  Fly   231 DFVSARCG--SVETLSASSC-------------RWSTHKMGQKQEEEQPASGIYFLETRQSSPFS 280

  Fly   315 QG 316
            :|
  Fly   281 RG 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 71/253 (28%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.