DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG6472

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster

Alignment Length:305 Identity:106/306 (35%)
Similarity:144/306 (47%) Gaps:47/306 (15%)


  Fly    24 DSLLNQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCT--HGSIMPLRNAYTAQGYENV 86
            |:.|.||...:..|.|                 :.:||:..|.|  ..|...|::|:..:|..||
  Fly    65 DARLAQSNFNFNYPLA-----------------IYLHGFSESATGERQSSQELKDAFLRRGNYNV 112

  Fly    87 LVADWGPVANLDYPSSRLAVKNV---AQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGR 148
            ::.||..:..:.:.|:  ||:|:   .:.||:.| .||...|...:.:|:||.||||.:||..|:
  Fly   113 ILIDWSAMTAVPWYSN--AVENLPVSGRYLARFL-RFLVDKGYPAKYIHLIGFSLGAEVAGFAGK 174

  Fly   149 YFNG---SLGRVTGLDPALPLFSSRSDD-SLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFG 209
            ....   .|.|:|.||||||||...|.: .|..:.|:||||||||..|.|:..|.|..|||||.|
  Fly   175 QLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNGG 239

  Fly   210 LAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLRE 274
            ...||||...::  |:..|.....|||.||..::.|||..|..|||..|.    .|.....| ||
  Fly   240 RPLQPGCAKQNI--ANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCE----PSDMFGIC-RE 297

  Fly   275 KSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQGRNS 319
            ...         ...|||...:......:||:||.|.|:  ||||
  Fly   298 PGG---------GPAFMGMGADPRIRGKFYLDTNDAKPF--GRNS 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 97/289 (34%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 100/294 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.