DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG7367

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster

Alignment Length:281 Identity:96/282 (34%)
Similarity:135/282 (48%) Gaps:28/282 (10%)


  Fly    40 DVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVA-NLDYPSSR 103
            |...|..|:.:.....|::|||:..|....||..:|.||..:|..||...:|...| |:.|.:..
  Fly   126 DTWQEMAEKFNPELDTKILVHGWKSSTMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYLTPA 190

  Fly   104 LAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFS 168
            .....|.:.:|||::..::........:|:|||||||||.|..|.|....:.|:||||||.|.|.
  Fly   191 RYTVQVGRAVAKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFE 255

  Fly   169 S--RSDDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEA 231
            .  ..::.|....|.||||||:.....|..:|.|.||||||.|..|||||:.:..:..       
  Fly   256 DCIGPENHLDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFT------- 313

  Fly   232 YSCSHNRAVMFYAESIGMPENFPAVSCS-LTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHV 295
             .|||.|:..:|||||..|:.|..|.|| |..:|.:   :|...|             :.||:.|
  Fly   314 -GCSHGRSYEYYAESINSPKGFYGVPCSGLDELKGK---NCTGGK-------------ILMGDPV 361

  Fly   296 NRSATLYYYLETNGAPPYGQG 316
            .|.|...::::|...|.|..|
  Fly   362 PREARGIFFVKTANKPSYALG 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 93/272 (34%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 93/272 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.