DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG18641

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster

Alignment Length:311 Identity:88/312 (28%)
Similarity:140/312 (45%) Gaps:54/312 (17%)


  Fly    26 LLNQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVAD 90
            :|:.:.:||            ...:.....|:|:||:.|..|......||.||.:.|..|:::.|
  Fly    88 VLDPNALYY------------THFNPRHPTKIIIHGFGGGRTLSPSPDLREAYFSVGEYNIIIVD 140

  Fly    91 WGP------VANLDYPSSRLAVKNVAQILAKLLEEFLQRH--GISLEGVHVIGHSLGAHIAGRIG 147
            :..      ::.:|: :.|.....::|::     ::|.||  |:..:.:|.||:|:||||||.:.
  Fly   141 YADAVKEPCLSQMDW-APRFGSLCISQLV-----KYLARHPRGVQPDDLHFIGYSVGAHIAGLVA 199

  Fly   148 RYF---NGSLGRVTGLDPALPLFSSRSDD-SLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNF 208
            .|.   .|.|||:|.|||.:..::..::. .|.|..|.||||:||...:.|.....|..|||.|.
  Fly   200 NYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHADFYVNG 264

  Fly   209 GLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLR 273
            | ..||.|      ..|..|.:..:|.|.:...::.|||.....|.|..|  ..:.|..:..|  
  Fly   265 G-TRQPAC------VGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPC--PNLFSYLIGWC-- 318

  Fly   274 EKSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPY-----GQGRNS 319
                    ...|.:.|.||||.:..|...||:.||...|:     |:||::
  Fly   319 --------EPKDSEYVLMGEHCSHKARGNYYVTTNAKAPFARGFPGKGRSN 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 82/292 (28%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 84/295 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.759104 Normalized mean entropy S7741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.