DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and CG5162

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:326 Identity:95/326 - (29%)
Similarity:147/326 - (45%) Gaps:78/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KPSADVSLENVE----------QLSSVES------------VKLIVHGYLGSCTHGS--IMPLRN 76
            |.|.|::..|.:          .|:|.||            |.::..|:. :..:||  |.....
  Fly    92 KYSPDINKMNFQLQTACEKKNFPLTSPESMWKSPLFDVKKKVVILATGWT-TTVNGSDTIEVFSK 155

  Fly    77 AYTAQGYENVLVADWGPVANLDYPSSRLAV----KNVAQILAKLLEEFLQRHGISLEGVHVIGHS 137
            ||..:|..|.:..|.....:..|..|....    :|:|..|.|||:.      :.:|.:|:||||
  Fly   156 AYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDL------VPVENIHLIGHS 214

  Fly   138 LGAHIAGRIGRYF----NGSLGRVTGLDPALPLFS-SRSDDSLHSNAAQFVDVIHTDYPLFGDIR 197
            |||||.|..||:.    |.::.|:||||||.|.|: ..:...|....|.||||||::..:.|...
  Fly   215 LGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRD 279

  Fly   198 PRGTVDFYPNFGLAP-QPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESI--GMPENFPAVSC- 258
            |.|.|||||. |::| ..||.:|             :|:|.|:..::||::  |...||.|..| 
  Fly   280 PVGDVDFYPG-GMSPLAAGCFSV-------------TCAHARSWEYFAETVFPGNERNFMATRCN 330

  Fly   259 SLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQG----RNS 319
            |::.::..|   |..::             |.||..|.::....|:||.:.:.|:|..    |::
  Fly   331 SISKLRDFR---CPGDE-------------VPMGYAVPQNIKGNYFLEVSASAPFGMHASVVRSA 379

  Fly   320 H 320
            |
  Fly   380 H 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 91/308 (30%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 90/311 (29%)
Pancreat_lipase_like 99..365 CDD:238363 88/302 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.