DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and CG18258

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster

Alignment Length:321 Identity:88/322 (27%)
Similarity:135/322 (42%) Gaps:65/322 (20%)


  Fly    13 CQFLGLHAALLDSLLNQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRNA 77
            ||...:.....:.|.|.:..|..:|:.                 |.:.|:..|..:.:..|:..|
  Fly   182 CQNTSIPLTQAEQLWNTTGFYQDRPTV-----------------LFITGWTTSINNSNSGPVAKA 229

  Fly    78 YTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLL---------EEFLQRHGISLEGVHV 133
            |..:...|||:.|.....:..|..|.|..:.:...|||.|         ::|           |:
  Fly   230 YLCRNDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNTSYVTKQF-----------HL 283

  Fly   134 IGHSLGAHIAGRIGRYFNGSLG-----RVTGLDPALPLFSSRSD-DSLHSNAAQFVDVIHTDYPL 192
            :||||||.|||..||.:....|     |:||||||.|.|...:: :.|.|..|:|||:|||:..:
  Fly   284 VGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGM 348

  Fly   193 FGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVS 257
            ||..:..|..||:....:..:||||::|.:          ||||.|||.::.|::     :|:..
  Fly   349 FGTSKRAGDADFFVQGRIPFKPGCESLDPI----------SCSHQRAVDYWTETV-----YPSNG 398

  Fly   258 CSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQGRN 318
            ....|.:.:|..:.|......||...       ||.....:....:|:..|...||||..|
  Fly   399 NDFLAKRCKRYSELLLGNYCKNTNTV-------MGYAAKATDLGLFYVGANPEEPYGQNAN 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 79/295 (27%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 83/311 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.