DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Lipi

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_011244435.1 Gene:Lipi MGIID:2443868 Length:485 Species:Mus musculus

Alignment Length:290 Identity:102/291 (35%)
Similarity:138/291 (47%) Gaps:43/291 (15%)


  Fly    58 IVHGY--LGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKN---VAQILAKLL 117
            |:|||  .|| |...:.....|:..|...|::|.||...|. .:..|| ||:|   ||:||.:.:
Mouse    95 IIHGYRPFGS-TPVWLSRFTKAFLKQEDVNLIVVDWNQGAT-TFMYSR-AVRNTRRVAEILRETI 156

  Fly   118 EEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSR-SDDSLHSNAAQ 181
            |..| .||.||:..|.||.||||||:|.:|:.|:|.|||:||||||.|.||.: |:..|:...|:
Mouse   157 ENLL-IHGASLDNFHFIGMSLGAHISGFVGKIFHGQLGRITGLDPAGPQFSRKPSNSRLYYTDAK 220

  Fly   182 FVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAES 246
            ||||||||....|...|.|.:|||||.| ..||||. ..:.:.:..:    .|.|.||:..:..:
Mouse   221 FVDVIHTDIKSLGIGEPSGHIDFYPNGG-KHQPGCP-TSIFSGTNFI----KCDHQRAIYLFLAA 279

  Fly   247 IGMPENFPAVSC-SLTAIKSRRVEDC-----------------LREKSKTNTENANDYQTVFMGE 293
            .....||.:..| |....|:....||                 .:|:.|..||......|.|:..
Mouse   280 FETSCNFVSFPCRSYKDYKNGLCVDCGNLYKDSCPRLGNQAKLWKEELKKKTEEWPLRTTAFLDT 344

  Fly   294 HVNRSATLYYYL-------ET--NGAPPYG 314
            ........||:.       ||  ||:..:|
Mouse   345 SSQNPFCTYYFALNIVALSETMRNGSISFG 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 99/283 (35%)
LipiXP_011244435.1 Pancreat_lipase_like 57..346 CDD:238363 95/261 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.