DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Yp1

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001285071.1 Gene:Yp1 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster

Alignment Length:254 Identity:75/255 (29%)
Similarity:120/255 (47%) Gaps:41/255 (16%)


  Fly    74 LRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSL 138
            ::||.|..|  :::|.|.|...|.....:.|.::.....:.|.:.:.:....:..:.:|:||.::
  Fly   194 VKNAKTQSG--DIIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNV 256

  Fly   139 GAHIAGRIGRYFNGSLG----RVTGLDPALPLFSSRSD-DSLHSNAAQFVDVIHTD-YPLFGDIR 197
            |||:||...:.|....|    |||||||:..:..|::. ..|....|:|||.|||. |.:...||
  Fly   257 GAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTPIR 321

  Fly   198 PRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESI--GMPENFPAVSCSL 260
             .|.||||||...|..||..|| |.||.            ||..::|||:  |...:||||..: 
  Fly   322 -SGDVDFYPNGPAAGVPGASNV-VEAAM------------RATRYFAESVRPGNERSFPAVPAN- 371

  Fly   261 TAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQGRNS 319
             :::..:..|...:::....:.|:|.:    |:         |.|:.|...|:  |||:
  Fly   372 -SLQQYKQNDGFGKRAYMGIDTAHDLE----GD---------YILQVNPKSPF--GRNA 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 70/242 (29%)
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.