DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and lpl

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio

Alignment Length:305 Identity:85/306 (28%)
Similarity:142/306 (46%) Gaps:36/306 (12%)


  Fly    29 QSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMP--LRNAYTAQGYENVLVADW 91
            :..:.|:.|....|:::. ..::.....:::||:..:....|.:|  :...|..:...||:|.||
Zfish    69 EDDLCYIVPGQPQSIKDC-NFNTETKTFIVIHGWTVTGMFESWVPKLVTALYEREPSANVIVVDW 132

  Fly    92 GPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGR 156
            ...|...||:|....|.|.:.:||.:...........|.:|::|:|||||:||..|......:.|
Zfish   133 LSRAQQHYPTSASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAGLLTKHKVNR 197

  Fly   157 VTGLDPALPLFS-SRSDDSLHSNAAQFVDVIHTDY-----PLFGDIRPRGTVDFYPNFGLAPQPG 215
            :||:|||.|.|. :.|..:|..:.|.||||:||:.     ...|..||.|.:|.|||.|.. |||
Zfish   198 ITGMDPAGPTFEYADSLSTLSPDDANFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTF-QPG 261

  Fly   216 C--ENVDVVAAS---KLLHEAYSCSHNRAVMFYAES-IGMPENFPAVSCSLTAIKSRRVEDCLR- 273
            |  :|..::.|:   :.:.:...|||.|::..:.:| :.......|..||.....::.:  ||. 
Zfish   262 CDLQNTMLMVATTGLRNMDQIVKCSHERSIHLFIDSLVNQDHESMAFRCSSRDSFNKGM--CLSC 324

  Fly   274 EKSKTNTENANDYQTVFMGEHVN-----RSATLYYYLETNGAPPY 313
            .|::.|.          :|..||     ||:.:  |::|....||
Zfish   325 RKNRCNK----------VGYAVNKIRTRRSSKM--YMKTREMMPY 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 83/299 (28%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 85/306 (28%)
Pancreat_lipase_like 56..353 CDD:238363 83/300 (28%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.