DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Lipi

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi RGDID:1310162 Length:476 Species:Rattus norvegicus

Alignment Length:292 Identity:105/293 (36%)
Similarity:138/293 (47%) Gaps:47/293 (16%)


  Fly    58 IVHGY--LGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEF 120
            |:|||  ||| |...|.....|:..|...|::|.||...|. .:...| ||||..:: |::|.|:
  Rat    95 IIHGYRPLGS-TPMWIHKFTKAFLKQEDVNLIVVDWNQGAT-TFIYGR-AVKNTRKV-AEILREY 155

  Fly   121 LQR---HGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSR-SDDSLHSNAAQ 181
            ::.   ||.||:..|.||.||||||.|.:|:.|.|.|||:||||||.|.||.: |:..|....|:
  Rat   156 IENLLIHGASLDNFHFIGMSLGAHICGFVGKLFQGQLGRITGLDPAGPKFSGKPSNCRLDYTDAK 220

  Fly   182 FVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLH--EAYSCSHNRAVMFYA 244
            ||||||:|...||.:.|.|.:|||||.| ..||||       .:.||.  :...|.|.|||..:.
  Rat   221 FVDVIHSDSQGFGILEPSGHIDFYPNGG-RNQPGC-------PTSLLSGMDYIKCDHQRAVHLFL 277

  Fly   245 ESIGMPENFPAVSC-SLTAIKSRRVEDC-----------------LREKSKTNTENANDYQTVFM 291
            |:.....||.:..| |....||.....|                 .:|:.|..||......|.|:
  Rat   278 EAFETNCNFVSFPCRSYRDYKSGLCVGCGNLYKDSCPRLGIQANLWKEELKKKTEEWPLRTTAFL 342

  Fly   292 GEHVNRSATLYYYL-------ET--NGAPPYG 314
            ..........||:.       ||  ||:..:|
  Rat   343 DTSSQNPFCTYYFALNIVALNETMKNGSLSFG 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 102/285 (36%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 98/263 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.