DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Pnlip

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_037293.1 Gene:Pnlip RGDID:3360 Length:465 Species:Rattus norvegicus

Alignment Length:307 Identity:85/308 (28%)
Similarity:138/308 (45%) Gaps:27/308 (9%)


  Fly    28 NQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPL-RNAYTAQGYENVLVADW 91
            |::...|.|.::|.|........:....::|:||::.......:..: :|.:..:.. |.:..||
  Rat    60 NENQDNYQKITSDASSIRNSNFKTNRKTRIIIHGFIDKGEENWLSDMCKNMFKVESV-NCICVDW 123

  Fly    92 GPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGR 156
            ...:...|..:...|:.|...:|.|:.......|...:.||:||||||:|:||..|:...|::||
  Rat   124 KGGSRATYTQATQNVRVVGAEVALLVNVLKSDLGHPPDNVHLIGHSLGSHVAGEAGKRTFGAIGR 188

  Fly   157 VTGLDPALPLFSSRSDD-SLHSNAAQFVDVIHTD-YPL-----FGDIRPRGTVDFYPNFGLAPQP 214
            :||||.|.|.|....:: .|....|||||.|||| .|:     ||..:..|.:||:||.|: ..|
  Rat   189 ITGLDAAEPYFQGTPEEVRLDPTDAQFVDAIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGM-EMP 252

  Fly   215 GCEN------VDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSC-SLTAIKSRRVEDCL 272
            ||:.      ||:....:...:..:|:|.|:..:|.:||..|..|...|| |.....:.:...|.
  Rat   253 GCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPTGFSGFSCSSYNVFSANKCFPCG 317

  Fly   273 REKSKTNTENANDYQTVFMGEHVNRSATLY--YYLETNGAPPYGQGR 317
            .|........|:.|.        .::..||  :||.|.....:.:.|
  Rat   318 SEGCPQMGHYADKYP--------GKTKELYQKFYLNTGDKSNFARWR 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 84/297 (28%)
PnlipNP_037293.1 Lipase 17..352 CDD:278576 84/302 (28%)
Pancreat_lipase_like 51..348 CDD:238363 84/298 (28%)
PLAT_PL 355..465 CDD:238857 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.