DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Lpl

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_036730.1 Gene:Lpl RGDID:3017 Length:474 Species:Rattus norvegicus

Alignment Length:281 Identity:92/282 (33%)
Similarity:134/282 (48%) Gaps:43/282 (15%)


  Fly    57 LIVHGYLGSCTHGSIMP--LRNAYTAQGYENVLVADWGPVANLDYPSS----RLAVKNVAQILAK 115
            :::||:..:..:.|.:|  :...|..:...||:|.||...|...||.|    :|...:||:.:..
  Rat    77 VVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQHYPVSAGYTKLVGNDVARFINW 141

  Fly   116 LLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFS-SRSDDSLHSNA 179
            |.|||    ...|:.||::|:|||||.||..|...|..:.|:||||||.|.|. :.:...|..:.
  Rat   142 LEEEF----NYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDD 202

  Fly   180 AQFVDVIHT---DYP--LFGDIRPRGTVDFYPNFGLAPQPGC---ENVDVVAASKL--LHEAYSC 234
            |.||||:||   ..|  ..|..:|.|.||.|||.|.. ||||   |.:.|:|...|  :.:...|
  Rat   203 ADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTF-QPGCNIGEAIRVIAEKGLGDVDQLVKC 266

  Fly   235 SHNRAVMFYAESIGMPEN-FPAVSC-SLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVN- 296
            ||.|::..:.:|:...|| ..|..| |..|.:......|  .|::.|.          :|..:| 
  Rat   267 SHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLSC--RKNRCNN----------VGYEINK 319

  Fly   297 ----RSATLYYYLETNGAPPY 313
                ||:.:  ||:|....||
  Rat   320 VRAKRSSKM--YLKTRSQMPY 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 90/275 (33%)
LplNP_036730.1 Interaction with GPIHBP1. {ECO:0000250|UniProtKB:P06858} 32..53
lipo_lipase 33..472 CDD:132274 92/282 (33%)
Pancreat_lipase_like 37..334 CDD:238363 90/276 (33%)
PLAT_LPL 341..465 CDD:238856
Important for interaction with lipoprotein particles. {ECO:0000250|UniProtKB:P06858} 417..421
Important for heparin binding. {ECO:0000250|UniProtKB:P06858} 430..434
Interaction with GPIHBP1. {ECO:0000250|UniProtKB:P06858} 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.